SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5I1X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5I1X6
Domain Number 1 Region: 149-228
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.33e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0005
Further Details:      
 
Domain Number 2 Region: 62-152
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.82e-16
Family Cold shock DNA-binding domain-like 0.0034
Further Details:      
 
Domain Number 3 Region: 7-61
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000194
Family ECR1 N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5I1X6
Sequence length 246
Comment (tr|A0A0B5I1X6|A0A0B5I1X6_9ARCH) Exosome complex component Rrp4 {ECO:0000256|HAMAP-Rule:MF_00623} KW=Complete proteome; Reference proteome OX=1579373 OS=archaeon GW2011_AR15. GN=QT06_C0001G1316 OC=Archaea.
Sequence
MDKTNLKINDKDVVVPGEILAEGMDYLPSQGTYRKDNHVIASMLGLARIEGKVIKIIPLS
GNYLPKRGDVIVGKVADINFSGWSVETNSAYAAMLSMKDATSDYIRRGEDLTKYFNIGDY
IVTKIYNVTSQNLIDLTMKGPGLRKLTTGRIMKVASPKVPRIIGKQGSMVSMIKKATNCN
IIVGQNGVVWIKGLNPEDELITVETIKKIEDESHVSGLTGIIQKFLESKGRKAVLETVTE
ETTGEA
Download sequence
Identical sequences A0A0B5I1X6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]