SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5II66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5II66
Domain Number 1 Region: 24-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000719
Family SMI1/KNR4-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5II66
Sequence length 173
Comment (tr|A0A0B5II66|A0A0B5II66_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AJF68074.1} KW=Complete proteome; Reference proteome OX=362257 OS=Streptomyces vietnamensis. GN=SVTN_30650 OC=Streptomyces.
Sequence
MATLSDIRALLGEPRFNWSDPAPWTALEQELGVEFPADFHEIVDAYGSISINGQLYLKHP
ASHLLHDLGTMIKQDLEFWREEDMAEFLPSRAGTGPGELLPVATATTGEMVFLRVPDEPS
SPWRVLVQEMDSPSWTLYEMTFGEWLLAYLKGRDVTLCARDRAPDGPSYEFLP
Download sequence
Identical sequences A0A0B5II66
WP_041132003.1.79049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]