SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5J913 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5J913
Domain Number 1 Region: 54-96
Classification Level Classification E-value
Superfamily F-box domain 0.000000000249
Family F-box domain 0.0034
Further Details:      
 
Domain Number 2 Region: 140-221
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000654
Family Pseudo ankyrin repeat 0.021
Further Details:      
 
Domain Number 3 Region: 92-201,277-380
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000204
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5J913
Sequence length 509
Comment (tr|A0A0B5J913|A0A0B5J913_9VIRU) Ankyrin repeat protein {ECO:0000313|EMBL:AJF97296.1} KW=Complete proteome; Reference proteome OX=1605721 OS=Pandoravirus inopinatum. GN= OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MLATAPASVGPLFCSCDLARFFSTHALALATPVALFCLLSLIISLIVLILAETRQTPMDD
LPDEILGLILFFVPCAVRLTRTALVCKRWHRVANDHAAVGRAPCVDKSLKGKGLCWMAAS
RGHADCLARARDCGRPWGDAIYHVAAHAGHITVLDYAHVHGCPPDARALEGAIDGGHLDA
VRWLCDHGHSWGAVSCARAAPHGDIALLVLLRERGCPWGYNVTRILADRGALDCLRYAHE
NGCPWASGTVSNLAAKGLLDGLRHAHENGCPWDDDACDRAAAAGHWACARYAHDNGCAWS
HVSNLTAKAAAAGDLATLTALCKCGCPWDKSTTRVAAEAGHPDCLRYAHENGCPWDEVTC
TRAIYADSFECLRYALEHGCPWRTSIHDFGHVIAVADLTIIKVVYAHTLSQSRWAAEAAR
NGRLDVLRFLVKRATILMARSWKRRRPPDTSTVSSTRMRMCRGTPTRTRSPKRLPNTAPS
TASNTRTTMALSGTAKWWKRPWKEAIATA
Download sequence
Identical sequences A0A0B5J913
YP_009119531.1.13463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]