SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5J983 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5J983
Domain Number 1 Region: 106-238
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000288
Family Pseudo ankyrin repeat 0.026
Further Details:      
 
Domain Number 2 Region: 3-47
Classification Level Classification E-value
Superfamily F-box domain 0.0000111
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5J983
Sequence length 286
Comment (tr|A0A0B5J983|A0A0B5J983_9VIRU) Ankyrin repeat protein {ECO:0000313|EMBL:AJF97396.1} KW=Complete proteome; Reference proteome OX=1605721 OS=Pandoravirus inopinatum. GN= OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MSIDGLPDEFLALVLYHVPCIVRARDCAPVCHRWRAIVADDKALEPCIHPRHLCLGKLAE
AIGTWGNSLSSLMGADSLPRSSPVLLAAVSKEHLHCMSYARSKGHAWGPDACDDAARCGR
LAALKWLIDAGCPHLVALYEGDSCTGHNLVGSPRGVHYYLHRRNIKPLMKEAIKGGHVSC
VDWLVSRGMRLDPTTCHMAAKRGHLDMLRYARANGARWDESVVCDSAVRGGQLDVLTYVQ
ADPLLLAKCPWYVAEKDGLPPRFCCGIGCKMSGLGCSMPSTTRTVP
Download sequence
Identical sequences A0A0B5J983
YP_009119631.1.13463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]