SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5JBW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5JBW6
Domain Number 1 Region: 226-277,374-410,556-655
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000202
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number 2 Region: 74-127
Classification Level Classification E-value
Superfamily F-box domain 0.0000000602
Family F-box domain 0.0074
Further Details:      
 
Domain Number 3 Region: 381-441,470-493
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000301
Family Pseudo ankyrin repeat 0.041
Further Details:      
 
Domain Number 4 Region: 167-316
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000919
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5JBW6
Sequence length 728
Comment (tr|A0A0B5JBW6|A0A0B5JBW6_9VIRU) Ankyrin repeat protein {ECO:0000313|EMBL:AJF98526.1} KW=Complete proteome; Reference proteome OX=1605721 OS=Pandoravirus inopinatum. GN= OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MLATPSSHGAVPTAARTLSPATASACVRGRATGASRGPTRKARAQRRTGRLAKRRAQAAQ
PMDLVEPSAERKQTDLSSSSSSTSIEVLPDELLAQVMGHLPCMDRRYGGPACVSRRWRSI
ALDEKTYVRPVCGQGLEGEDPYASAVRLFHVDCIEYALERRRTQTVNACVEAAVRGRFDL
AVRFFERGCAWDAPEMAAAAAAAGHVHVLAALHETGAPTDDPRVCTAAAAGGHLSCLDYA
HTAGFPWDAKTAAGAAASGSLGCLTYLHHRGCPWDSKATKAALDPRRFKHPRPVTDIDTK
DNLDGRLACLRYLIANKCPWHHNAFEVAAGSGAQMLTLALDLGCPFDVDIDDDVGDQVVC
SGDAESVTLLATRGYKWGWSDLDEAVRFGQPKMLGALVDAGAPWDTDLAARLVRHNDSEL
MQWVIDRGLAWDIEKCMMEAIPAYGTLYRWFIESGYECPRLAKFCLHAVKCRQHEALEWL
LVHDFPWDPVAAAALMPDIGNYCLAVLAKAGLIGAGPCEDSAVLCERAAGHDYKHDGGAT
IRTLYALGHRGDARATAAAGTAGNIETLRWLVSQGCPVDHTTMTTISAAWGDHVDCLRYL
CEAGHACNADVYAAAIRGGNIACLAYLDQRRCPRPDHPALLASQSGRLSPLRYLREQIGV
PLHPDACVIAIQKGNVACLRYAHKHGCEIDMDRCMAALDSCWSGRTECERYLVAQCDAGR
PPSPPQKP
Download sequence
Identical sequences A0A0B5JBW6
YP_009120761.1.13463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]