SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5KRR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5KRR1
Domain Number 1 Region: 130-288
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 5.1e-78
Family Retrovirus capsid protein, N-terminal core domain 0.0000001
Further Details:      
 
Domain Number 2 Region: 2-135
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.73e-63
Family Immunodeficiency virus matrix proteins 0.00000172
Further Details:      
 
Domain Number 3 Region: 279-361
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.75e-32
Family Retrovirus capsid protein C-terminal domain 0.000017
Further Details:      
 
Domain Number 4 Region: 383-428
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 3.26e-16
Family Retrovirus zinc finger-like domains 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5KRR1
Sequence length 498
Comment (tr|A0A0B5KRR1|A0A0B5KRR1_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASVLSGGKLDAWEKIRLRPGGKKKYRLKHLVWASRELDRFALNPSLLETTEGCQQI
IEQLQPVLRTGTEEVKSLFNTVAVLYCVHRKIDVKDTKEALDKIEEIQNKSKQKTPQAAA
GAGNSSVSQNYPVVQNAQGHWVHQNFSPRTLNAWVKVIEDKGFSPEVIPMFSALSEGATP
QDLNMMLNIVGGHQAAMQMLKDTINEEAAEWDRAHPVHAGPIQPGQMREPRGSDIAGTTS
TPQEQIAWMTNNPPIPVGDIYKRWIILGLNKIVRMYSPVSILDIKQGPKEPFRDYVDRFF
KTLRAEQASQDVKNWMTETLLVQNANPDCKSILRVLGAGATLEEMMTACQGVGGPGHKAR
VLAEAMSQVQNTNIMMMQRGNFKGQRKIKCFNCGKEGHLAKNCRAPRKKGCWKCGKEGHQ
MKDCTERQANFLGKIWPSSKGRPGNFPQSRPEPTAPPAELLGMGEEIASPPKQEQRDKEQ
GPPLVSLKSLFGNDPLSQ
Download sequence
Identical sequences A0A0B5KRR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]