SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5NRF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5NRF9
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.1e-55
Family AadK C-terminal domain-like 0.000059
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.58e-49
Family AadK N-terminal domain-like 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5NRF9
Sequence length 290
Comment (tr|A0A0B5NRF9|A0A0B5NRF9_BACTU) Streptomycin adenylyltransferase family protein {ECO:0000313|EMBL:AJG79040.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=BF38_3177 OC=Bacillus cereus group.
Sequence
MRTEKEMMDLIINTAKEDERIRAVIMNGSRVNPNVKKDCFQDYDVIYAVKDIRSFTSNHN
WIHRFGAIMMVQMPEEMLLVPPDRDGKFPYLMQFMDGNRIDLTLAPVELINNFVRQDSLS
KLLLDKDNCMEGFPPASDKDYLIKKPTEKEFLDCCNEFWWCSTNVAKGLWREELSYVKGM
LDGPVRDMLIVMLEWHIGMKTDFIVNAGKFGKHFEKYIEKDMWVQFKRTFSNAEYENIWE
SFFVMGNLFREVANEIANAYGYPYPQGDDDRVTSYLKHVKALPKDSTSIY
Download sequence
Identical sequences A0A0B5NRF9 A0A1N7UTR5 B7JKF5 C2TFB8 C3GHP3
gi|218903114|ref|YP_002450948.1| WP_001258549.1.100059 WP_001258549.1.16013 WP_001258549.1.23615 WP_001258549.1.29804 WP_001258549.1.42217 WP_001258549.1.45919 WP_001258549.1.63137 WP_001258549.1.7545 405535.BCAH820_1997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]