SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5QKL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0B5QKL0
Domain Number - Region: 62-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000126
Family Family 1 bi-partite nucleotidyltransferase subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5QKL0
Sequence length 142
Comment (tr|A0A0B5QKL0|A0A0B5QKL0_CLOBE) Uncharacterized protein {ECO:0000313|EMBL:AJG98771.1} KW=Complete proteome OX=1520 OS=Clostridium beijerinckii (Clostridium MP). GN=CBEIJ_51330 OC=Clostridium.
Sequence
MNQERLIKIVEDFQECISDIDECIEILENNSDNKIMIKLAKSSLRQLFVSFNTILEDFTS
VTLKSLKKYKIGMTLNDSLEVLKEEKVLDAELFNFLEKSRLLRNRISHRYKEPAHAELFE
HVVKYKDDFKKILNIAKQYLKE
Download sequence
Identical sequences A0A0B5QKL0 A0A0K2MF73 A6LV04
290402.Cbei_2014 WP_012058245.1.15846 WP_012058245.1.16915 WP_012058245.1.24330 WP_012058245.1.44456 WP_012058245.1.51202 WP_012058245.1.6721 WP_012058245.1.88565 WP_012058245.1.91641 WP_012058245.1.95078 WP_012058245.1.96201 gi|150016886|ref|YP_001309140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]