SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5RLG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5RLG0
Domain Number 1 Region: 29-93,146-204
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000353
Family SMI1/KNR4-like 0.0093
Further Details:      
 
Domain Number 2 Region: 238-294,355-405
Classification Level Classification E-value
Superfamily ARM repeat 0.000000472
Family PBS lyase HEAT-like repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5RLG0
Sequence length 449
Comment (tr|A0A0B5RLG0|A0A0B5RLG0_9FLAO) Cell wall assembly protein {ECO:0000313|EMBL:AJH15640.1} KW=Complete proteome; Reference proteome OX=480520 OS=Myroides profundi. GN=MPR_2474 OC=Flavobacteriaceae; Myroides.
Sequence
MNVQIERIKDKLSTIKDFDQEYQVFGASSHQYGIGEVVRHTDIKHFEQEYNLELPEAYVA
FLTQVGNGTNQEDAYGSSAAGPYYGIYPLGTNLIDVFVEDIKKSIAQACILDPKMTKEEW
EALTLALQEDDLSDEDYYEIQNKLFSGLLAIGTQGCAITTCLVMNGEHRGRIVYINEDYQ
PSFAYEAHFLDWYERWLDEIISGELVSKDAGWFGYARGGSSELLWESFKTIEDKEEKLEY
LVGLIRKKEISEAILQEIEYVLSEKCDDDIRSSLTMILAKVAFTRAIPFIKELIGQNLLV
SLKIIHWYAEDKAYWLPFITPLSDTIDEEETFRFYTYVVSKATDDYGDYILAGLQSANQA
IRATAIYTLGEAKNKKDYLNQFIKCLHDDDERVVLYALQGLKEVNDERLLSCYKVVYKKY
KDSEEENYIIVNLEHRLKELGLSLEELER
Download sequence
Identical sequences A0A0B5RLG0
WP_041892979.1.82723 WP_041892979.1.87173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]