SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5RQU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5RQU6
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000209
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5RQU6
Sequence length 229
Comment (tr|A0A0B5RQU6|A0A0B5RQU6_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:AJH15446.1} KW=Complete proteome; Reference proteome OX=480520 OS=Myroides profundi. GN=MPR_2275 OC=Flavobacteriaceae; Myroides.
Sequence
MTITELEQKYNIVYPELYKQLEQDNMLEVGEYSQMWYATTFPKLKDNPPLLLFSDDFELT
PLKDVDEDIAWLRDPDNYMEIKEEYNFISFAKNGAGDMYCFFMSEETDGDYPIVFVWHDD
IEATYEAKNLRDFIFKRIVSDMSQLDTYNNQSDEEFIENLRATLKTHTQYLSDDKVALLK
ELIERPIIDYTIEGWSEKCRGVLTDIEYKEILEKYIPYEKMNVSFPYSE
Download sequence
Identical sequences A0A0B5RQU6
WP_041892650.1.82723 WP_041892650.1.87173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]