SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5RTY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5RTY2
Domain Number 1 Region: 22-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000706
Family SMI1/KNR4-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5RTY2
Sequence length 163
Comment (tr|A0A0B5RTY2|A0A0B5RTY2_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:AJH16601.1} KW=Complete proteome; Reference proteome OX=480520 OS=Myroides profundi. GN=MPR_3489 OC=Flavobacteriaceae; Myroides.
Sequence
MSKFNHYTVIPNIHTQSSELVLPSVEDINNCEQVLNFNFEEDYKTYILQYGVGVLGGTYI
RIYAPNRIITERKEWLERVTQYYFWDDGKDVLTKEQVLEGICIGDTFDGDEIIFYNNTYF
VLPRHEEDIYVLGNNLYEAIEWLCTKGILTEAFSEREFEPFNE
Download sequence
Identical sequences A0A0B5RTY2
WP_041894736.1.82723 WP_041894736.1.87173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]