SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5S255 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5S255
Domain Number 1 Region: 34-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000249
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5S255
Sequence length 186
Comment (tr|A0A0B5S255|A0A0B5S255_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:AJH15484.1} KW=Complete proteome; Reference proteome OX=480520 OS=Myroides profundi. GN=MPR_2313 OC=Flavobacteriaceae; Myroides.
Sequence
MKLFEIEEVSVFLEKKFADVDKDIISELLLIPYKGSKEEVLRLKEYLNIAILPEEFEDFI
MRYNLGNLTLANIQFGSGGNYINRLINLNNKDNYWYQDCLSIDAMVVGLGDPYTILLSLK
EGVVYVVSSEISFDDKVIVAPSFDSFIQGLGTSVYVKESGKEESFLSLIENEFGVNTRFF
WEEILY
Download sequence
Identical sequences A0A0B5S255
WP_041892712.1.82723 WP_041892712.1.87173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]