SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5S3K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5S3K3
Domain Number 1 Region: 36-101
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000127
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5S3K3
Sequence length 111
Comment (tr|A0A0B5S3K3|A0A0B5S3K3_BACMY) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AJH16863.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=BG05_5730 OC=Bacillus cereus group.
Sequence
MLSTQEMIESSKEEEDVSYLLEYQDDEDAVDSKINPEGLLPGTYIHFSDCMNNGGTSKLY
IDFNPSDEGVCGQIIRFLHDPDEYEVIANSFDEYLQNLIDGNFNFLDEEES
Download sequence
Identical sequences A0A0B5S3K3 A0A1I6CFC5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]