SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5S909 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5S909
Domain Number 1 Region: 10-48
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000863
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5S909
Sequence length 76
Comment (tr|A0A0B5S909|A0A0B5S909_BACMY) Putative sMI1 / KNR4 {ECO:0000313|EMBL:AJH21831.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=BG05_4986 OC=Bacillus cereus group.
Sequence
MKIKNGSKLQSPNDELIESFEEYCEIKLPTDFIDFLKKYNGSIPITNVFLHEKNELLIER
FLCLFIKPIAEGFPQV
Download sequence
Identical sequences A0A0B5S909 A0A1I6C0U6 A0A243E6S7 A0A2C2FN58 J8EY90 W4E2H6
WP_000694783.1.101720 WP_000694783.1.20051 WP_000694783.1.20881 WP_000694783.1.27729 WP_000694783.1.27732 WP_000694783.1.36226 WP_000694783.1.37635 WP_000694783.1.38645 WP_000694783.1.39255 WP_000694783.1.61820 WP_000694783.1.61919 WP_000694783.1.6426 WP_000694783.1.68186 WP_000694783.1.72867 WP_000694783.1.75292 WP_000694783.1.89325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]