SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5X4W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5X4W3
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.46e-31
Family Ribosomal L27 protein 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5X4W3
Sequence length 96
Comment (tr|A0A0B5X4W3|A0A0B5X4W3_BACCO) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome OX=1121088 OS=Bacillus coagulans DSM 1 = ATCC 7050. GN=BF29_922 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLKLDLQFFASKKGVGSTKNGRDSIAKRLGAKRADGQFVTGGSILYRQRGTKVFPGENVG
RGGDDTLFAKVDGVVRFERLGRDKKKVSVYPVAQEA
Download sequence
Identical sequences A0A0B5X4W3 A0A0C5CM24 F7Z033 G2TLZ3
gi|347753042|ref|YP_004860607.1| gi|336114527|ref|YP_004569294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]