SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5XH29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0B5XH29
Domain Number - Region: 22-91
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0745
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B5XH29
Sequence length 114
Comment (tr|A0A0B5XH29|A0A0B5XH29_BACTU) Uncharacterized protein {ECO:0000313|EMBL:AJG79345.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=BF38_453 OC=Bacillus cereus group.
Sequence
MKQQPKIAELLKRIETSKQQDIELGTYEIYLFSQNELEKGQIGYRYDKHKNSLISKEHGK
WKDEWIVIGYETDMGDPVFVNIDDDAYPVYTAERGTEVWQPVHIGNIDEIIKQL
Download sequence
Identical sequences A0A0B5XH29 A0A0F5RQ81 A0A0K6KTG7 A0A1J9WI63 A0A242W6E6 A0A246UEL9 B7JS66 C2TN01 C3GQ84 Q632Z9
gi|218905920|ref|YP_002453754.1| gi|52140810|ref|YP_086018.1| WP_000813337.1.100059 WP_000813337.1.15163 WP_000813337.1.16013 WP_000813337.1.20665 WP_000813337.1.23615 WP_000813337.1.29451 WP_000813337.1.29804 WP_000813337.1.30336 WP_000813337.1.33536 WP_000813337.1.35255 WP_000813337.1.41365 WP_000813337.1.42217 WP_000813337.1.45919 WP_000813337.1.51167 WP_000813337.1.55968 WP_000813337.1.63137 WP_000813337.1.67239 WP_000813337.1.69970 WP_000813337.1.71953 WP_000813337.1.7545 WP_000813337.1.79687 WP_000813337.1.85901 WP_000813337.1.95308 288681.BCZK4441 405535.BCAH820_4808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]