SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6AB99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6AB99
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-21
Family SMI1/KNR4-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B6AB99
Sequence length 147
Comment (tr|A0A0B6AB99|A0A0B6AB99_BACMB) SMI1-KNR4 cell-wall family protein {ECO:0000313|EMBL:AJI20816.1} KW=Complete proteome OX=1348623 OS=15308 / NCIMB 9376 / NCTC 10342 / VKM B-512). GN=BG04_5225 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKIELLNAVDQEFERYPEAFGGAVTSEEVTQAEAKLKVKLPEDFKRFPLRYGSGAIGEAV
VLGLREAEFVSTPSFVDKSLQFRNMLPQGYEHFVVIGVDSAGNPVGFQYPNKEIVIVDFD
FGGKKVIAGSFEEYLEKSIREELNIHF
Download sequence
Identical sequences A0A0B6AB99
WP_034651280.1.44691 WP_034651280.1.61351 WP_034651280.1.91935 WP_034651280.1.94149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]