SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6AIA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6AIA1
Domain Number 1 Region: 16-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000157
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B6AIA1
Sequence length 142
Comment (tr|A0A0B6AIA1|A0A0B6AIA1_BACMB) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AJI23256.1} KW=Complete proteome OX=1348623 OS=15308 / NCIMB 9376 / NCTC 10342 / VKM B-512). GN=BG04_5211 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MADFKFINNGENKIYNLSEKEILKAEDRMGIRFPDDLRQLYLEVGYGFIKEPSNNAINRI
MGPGTVANVKLREGVFEFDPDLEELDEEDKLIFFEVNEGIYISLDLKLPNNPVFYFDTQI
ADSLEDFFKKFINDNEYYIDLE
Download sequence
Identical sequences A0A0B6AIA1
WP_034651306.1.44691 WP_034651306.1.61351 WP_034651306.1.91935 WP_034651306.1.94149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]