SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6B0S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6B0S9
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000249
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B6B0S9
Sequence length 128
Comment (tr|A0A0B6B0S9|A0A0B6B0S9_BACMB) Uncharacterized protein {ECO:0000313|EMBL:AJI25779.1} KW=Complete proteome OX=1348623 OS=15308 / NCIMB 9376 / NCTC 10342 / VKM B-512). GN=BG04_5843 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKHYNGCTVIDSTPLTAINKRWQIERFLGIIKNFSEHPYGVYNIGCCETSLGEQGRNFYD
EDLIGSELIPIAKLAWGDYLCLNFHYDKNNPSVDFLDYEESYECDPATSKIADTFQEFLS
MLLSKDTK
Download sequence
Identical sequences A0A0B6B0S9
WP_051975657.1.44691 WP_051975657.1.61351 WP_051975657.1.91935 WP_051975657.1.94149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]