SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6X7E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6X7E7
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily BH3703-like 2.22e-16
Family BH3703-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B6X7E7
Sequence length 113
Comment (tr|A0A0B6X7E7|A0A0B6X7E7_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDM88633.1} KW=Complete proteome OX=40576 OS=Xenorhabdus bovienii. GN=XBW1_1276 OC=Morganellaceae; Xenorhabdus.
Sequence
MSLDDKIYAEIGQLLYNAAPDDAKKIIMDTELSPEGDCCQFKYDYINSADEMNWFSPQGN
DGLTNERVRELLVSLRQFFIENINSKQPPHWSGCIVTVDVEKMKLNVDFKYED
Download sequence
Identical sequences A0A0B6X7E7
WP_046336257.1.30251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]