SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6XXN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6XXN1
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.65e-24
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B6XXN1
Sequence length 114
Comment (tr|A0A0B6XXN1|A0A0B6XXN1_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK48618.1} OX=1028688 OS=Arion vulgaris. GN=ORF4648 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
VCDIGDASRGSLSSYAYILMMLYYLQQVKPPVIPVLQELYKGKDKPKLMIEGWDAWFMDD
LSQLDEFWPEKGKNQMSVAELWLGFLCFYVEEFKHTEYVVSIRQKEPLTRFEKL
Download sequence
Identical sequences A0A0B6XXN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]