SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6Y5Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6Y5Y0
Domain Number 1 Region: 9-55
Classification Level Classification E-value
Superfamily Sema domain 0.000000101
Family Sema domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B6Y5Y0
Sequence length 72
Comment (tr|A0A0B6Y5Y0|A0A0B6Y5Y0_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK51468.1} OX=1028688 OS=Arion vulgaris. GN=ORF13491 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
LVVSFSPDFSSGPGLSSLCVYHMENIDKVFAETVQNCYDGQGKVGPAHYETVRTCMRTSE
PVDLCANTALSQ
Download sequence
Identical sequences A0A0B6Y5Y0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]