SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6YTZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6YTZ0
Domain Number 1 Region: 111-232
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.64e-35
Family cAMP-binding domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 241-364
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-30
Family cAMP-binding domain 0.000002
Further Details:      
 
Domain Number 3 Region: 9-54
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 4.05e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B6YTZ0
Sequence length 374
Comment (tr|A0A0B6YTZ0|A0A0B6YTZ0_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK59266.1} OX=1028688 OS=Arion vulgaris. GN=ORF35732 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
ANIDEEQSLKECEAYVQKHNIQQMLKECIVQLVVNKPDSPLNFLRDYFDRLEKEYAIQGK
NKSSTPPSDEKDEDLSSTPPHPAMNKRDRRGAVSAEVYKEEDAAQYVKKVVPKDYKTMAA
LSKAISRNVLFSHLDDTERSDIFDAMFPVHRHSGEIIIQQGDEGDNFYVIDQGEVDVYVN
GAHVTSIGEGSSFGELALIYGTPRAATVKAKTDSKLWGIDRDSYRRILMGSTIRKRKIYE
DFLSKVSILENLDKWERLTVADALEPVLFEDKEEIVRQGEPGEDFFIILEGVAAVLQRRS
DSEEAMEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCSEILK
RNISQYNSYVSLSV
Download sequence
Identical sequences A0A0B6YTZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]