SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6ZC51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6ZC51
Domain Number 1 Region: 31-159
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 1.44e-38
Family Nicotinic receptor ligand binding domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B6ZC51
Sequence length 159
Comment (tr|A0A0B6ZC51|A0A0B6ZC51_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK66002.1} OX=1028688 OS=Arion vulgaris. GN=ORF56981 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MDSFHCMWSFLFLLLMVSFGDMIKDKPDPAAKQLFYDIMKASGYNALIRPSAGPNPEDKL
TVKLGLRLSQVLSVDEKNQILTISVWLRQEWYDLRLRWDPLEYGDVKVLNIPSEELWKPD
LVLYNNADGDFQITLKTKAIIYNDGRIVWEPPAIYKSYC
Download sequence
Identical sequences A0A0B6ZC51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]