SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6ZS05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6ZS05
Domain Number 1 Region: 182-265
Classification Level Classification E-value
Superfamily EF-hand 3.46e-19
Family Osteonectin 0.04
Further Details:      
 
Domain Number 2 Region: 70-138
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.28e-18
Family Thyroglobulin type-1 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B6ZS05
Sequence length 288
Comment (tr|A0A0B6ZS05|A0A0B6ZS05_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK71424.1} OX=1028688 OS=Arion vulgaris. GN=ORF78306 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
TLCLGVDIKPNAVDAVDKDSAKLPVDHLREELLLWPSSSILQTPDLPVISGGPTSDNSAS
RQDIQNQKETNQSCKEEREAALNINSQEPAAKHFIPTCTQAGLWEKEQCHQSTGYCWCVK
DSGTPIPGTATYKVKPQCVFENDREMKGCPFEQKRKFLVDLLSDLAEERKKTLLEASNQT
DTGPDDNLSLRETVARWKLKMLDTNNNGIFDRKEWRPFRRTNLKNKNYSRKCRRGFLRFC
DKDGNQKITSEEWKDCLGLNQNNFNSLPLNPKRKGKNPLNLINYLNGD
Download sequence
Identical sequences A0A0B6ZS05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]