SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7A845 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7A845
Domain Number 1 Region: 39-93
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000418
Family Tachycitin 0.028
Further Details:      
 
Domain Number 2 Region: 102-165
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000034
Family Tachycitin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7A845
Sequence length 205
Comment (tr|A0A0B7A845|A0A0B7A845_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK76181.1} OX=1028688 OS=Arion vulgaris. GN=ORF98855 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MLTMLLDIFIYTVAVVCMTGDVSAATPNQCPQPTDGDSVAISFYYANPDECSSFYQCDKG
IPVLKYCSNNTVWNDDYKTCVIFNSYLDTCTQRNVQRECARPEFQGRLIAHPTVCSRFFN
CSKTEKPSMYSPFTQYEVECTYPDSFDVTQKKCVPYWATNCGSQRIVSKSPCDYLNNRCW
RSHCEPCDSRLPSCVGLSDGNHKHP
Download sequence
Identical sequences A0A0B7A845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]