SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7A904 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7A904
Domain Number 1 Region: 6-14,132-309
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.99e-52
Family G proteins 0.000000175
Further Details:      
 
Domain Number 2 Region: 18-139
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.57e-41
Family Transducin (alpha subunit), insertion domain 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7A904
Sequence length 311
Comment (tr|A0A0B7A904|A0A0B7A904_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK77167.1} OX=1028688 OS=Arion vulgaris. GN=ORF103274 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
ALPISIVKQMKIIHEGGFTSEDNKQYKPVVYSNTIQSLVAIIRAMGTLSIPFGDNERETD
AKMVLDVIARMEDTEPFSEELLAAMKRLWVDSGVQECLGRANEYQLNDSAKYFLDDLDRL
GGKDYMPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAII
FCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSP
LMLCFPEYTGKQIYQEASAYIQAQFEAKNKSSAKEIYCHQTCATDTNNIQFVFDAVTDVI
IANNLRGCGLY
Download sequence
Identical sequences A0A0B7A904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]