SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7AHA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7AHA1
Domain Number 1 Region: 103-225
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.51e-32
Family cAMP-binding domain 0.0000116
Further Details:      
 
Domain Number 2 Region: 236-360
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-31
Family cAMP-binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 3-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000458
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7AHA1
Sequence length 366
Comment (tr|A0A0B7AHA1|A0A0B7AHA1_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK80384.1} OX=1028688 OS=Arion vulgaris. GN=ORF120622 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MNLEIPDGLGDLLRDFTVAVLKERPGDLYDFAVDYFTEARESRRPKDVPMYIIVEDDDEA
GEPERTAFKPKCSSGRYARRQSVSAERYNPEEDEDDDDNVIYPKTDEQRERLTKTVSGIL
LFRSLEPEQTSEVIDAMFEKKVVPGETVIIQGDDGDNFYVIDTGAYDVLVDVKGEEKKIH
QFDNKGSFGELALMYNMPRSATVRAFTEGTLWAMDRSSFRRIVLKSAFKKRKKYEDLLES
VTILQNLDRYERMTLADALVPRVYQDEEAIIRQGDDPDGLYFVEDGHIRITMTSPDGTEK
EIGVKTTSTYFGELALIENKPRTASVYAVGRVKVAFLERDCFERLLGPCVEIMKRNSQQY
TMSVSN
Download sequence
Identical sequences A0A0B7AHA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]