SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7AJY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7AJY7
Domain Number 1 Region: 98-203
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-33
Family Second domain of FERM 0.0000649
Further Details:      
 
Domain Number 2 Region: 201-354
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-30
Family Third domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 15-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.63e-25
Family First domain of FERM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7AJY7
Sequence length 404
Comment (tr|A0A0B7AJY7|A0A0B7AJY7_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK81324.1} OX=1028688 OS=Arion vulgaris. GN=ORF125487 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MSLFKRSKSDALTEYTCSIRFLDDTESIQLTFKKDTLGQWLFDRVCEKLNLIEKDYFGLR
YVDAENQRHWLDPLKTVYKQLKGLSKMVLCFRVKFYPEDPMKLHEEITRYYLFLQLRRDL
HHGRLLCPHEESIQLAAYIIQSEVGDYDPQDHPIGYVSNFKMLPKQTPKHEEKIMDAHKA
LVGEVPSECEADFLKKASSMDTYGVDPHQVKDQKGEPLYLGVTHLGIMTFRGSRRTQLFK
WLQIRRIAYEGKMFIINHTSSEDEDVSNSKKRHQAVGFKCQTAPAAKYLWRCAVEQQLFF
TLSTSSAAPKIRSGGTLFSRGSKFRFSGRCQNEAYEASGNIRRTEPPFARTSSLPNFAKK
NHGHDNKNNTRQHSLASQSFREERRPLHGKLFFTYMHTPTDLIE
Download sequence
Identical sequences A0A0B7AJY7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]