SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7ARZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7ARZ8
Domain Number 1 Region: 28-124
Classification Level Classification E-value
Superfamily TNF-like 0.00000000932
Family TNF-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B7ARZ8
Sequence length 137
Comment (tr|A0A0B7ARZ8|A0A0B7ARZ8_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK82761.1} OX=1028688 OS=Arion vulgaris. GN=ORF133434 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
PTIGFSACDLSFGLSNGYASRSLRNFSHIINVGNHFNPVNGYFTAPQGGLYATFLSVQCH
KSLDLYFAIKKKPCNSCYNGDECQCNVGEISTSNDQSRGCAFEIVNMKTGDYLWAIYENA
AKIFCKLNIMFVCIKIG
Download sequence
Identical sequences A0A0B7ARZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]