SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7AST3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7AST3
Domain Number 1 Region: 83-272
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.9e-23
Family Hemopexin-like domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000012
Family Matrix metalloproteases, catalytic domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7AST3
Sequence length 310
Comment (tr|A0A0B7AST3|A0A0B7AST3_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK83021.1} OX=1028688 OS=Arion vulgaris. GN=ORF134745 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MGLGHSDDPNAIMFPVYREVAELGQDDINGIEELYGPNRGVRPVSPDGSRPRTPAPPVFR
RTPDTRAPPYQTVRPGLTTQMPVDLCRTINVDAVFEEPTSTWIGRIYVAVSDENVHTITQ
HGDLIKSRLLKDVYPEVPVNPDVAFSISKKKTVYFIKDNTMWAYKEGLLEAGYPRSLRSL
QFPERPKFSVTINHRDGTSRLLLFGARFWWTFDVDRLNTIVYQPISAFSGEMPSGVRFAT
QWTDNNLYAVTQDSYVIMDLDRRRITHEKPIAGMPKWLQGLCVDANSASRSVTSLSTLLI
IASILKTVFL
Download sequence
Identical sequences A0A0B7AST3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]