SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7BJT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7BJT2
Domain Number 1 Region: 776-1000
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-53
Family DBL homology domain (DH-domain) 0.00000162
Further Details:      
 
Domain Number 2 Region: 1005-1136
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-29
Family Pleckstrin-homology domain (PH domain) 0.0000497
Further Details:      
 
Domain Number 3 Region: 290-448
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.3e-26
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 4 Region: 39-117
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 508-572
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B7BJT2
Sequence length 1652
Comment (tr|A0A0B7BJT2|A0A0B7BJT2_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK93152.1} OX=1028688 OS=Arion vulgaris. GN=ORF192392 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MSLSDRLASISTRDEPSSLLGRRDKDVDSSDGSGGNLMQKCVIIQRDEKGYGFTVSGDNP
VFVASVKQDGAAAKAGVQNGDRIVKVNGTLVTQRNHLDVVKLIKSGSYVALTLLGKPSSS
GSSGGTATHPSGLSYIRDSVIGRVTAPQPVDPDKDREMWQQKVRVTRAMYETAKEDFEKL
QKLYVSKPSEKLHGQLLEKERTVKILDNQLKQLTGGEEPVMASQLPTATSDLGSMSDSSQ
TSPSLSPTPDDPHSRHNGQNIEFLTSQPEIIHPEYEEDNSDEDQVNDPGPFAEMKLLENK
PAHMAVLLNYLISNSDPSAVLFHIISDLYSRSPGSNKELRKWAYEIFSTFVYNMAPLSIS
VEDNIISQIDSILTSSGTRTDNENVLRTMFHAPRQSVQTEITELLTDFRSKKDLGMGNLY
GIQNIHDNMDRAAESKVAEELLMPHLKYFGAEDNSRGVMVDKDLATGWALATFLRSLGGA
KSANSAILDRVQTFMMRDKKSIKFPGSRSSRAKAVKGHQLNLQHFYVTTFCTFCGNLIWG
VGYQGYQCHNCEMTLHKSCAEEMTEVCGGKQKRRISARLPLSGVITNRRPNSNSTGVAPQ
LSYSATDQMSQPSPNPGRSPSQTEAVTQPYPKEEDSELAGLSGGHSVQNMVNRFQELVSP
VGPAQGNIGGSAQQDVSETLAGHNTERRDSSSLNRTGSLNNKGKKSERPARRAKSDVDMG
SDTFKDMNQSASSSASSLSNRSVDSPGSSIDNVNDLLRAQYDDPDMDLEPDLPPLKQVLP
EDVLRKLKPKEKKRQEVINELFYTERAHLRNLKVLDLLFNRPMYQEKGIMAELARALFPN
MEEMISLHVTFVRAIKERSVCTPVITDVGDLLLQRFGGEAGDIFCKGCTEYCRNQAFALD
ALKKQTRKEMKLQQFLHDAESNSLCRRLQLKDLVPSQMQRLTKYPLLIDSLLKYTQPQSE
EYMRLERAHVKCKNILALVNQAVKECENYHKLKEIQKKLDRKSLDGFNDPTILELKSLDL
TQHKLIFDSALIWKLRSHRTVDLHVLLFEDLLVLLQKQDDRYLLKCQNTNVQPTRDDKYT
HFPVLKLQNLLARTLATEKRSFFVVNISESRAQMYEFTAASSELRLKWCKLINEKADELK
TISNLPYLHSNDPSQVSQAAQAAGLSSIPPHNISDQFEQTSSSAQENIFEVTEQLSRRLN
IGEDAQSEGGLILPEEVSVSDAVTSKSSTDSSPQELLHLNWLQLENALSEKGHILANMLN
LSWNQCLAITTKPSDALVSRGREEEEGCYEDGDKAAECLVAKALEISCLLMSLVTGSVQV
LGKEAAQHMRDTSNPSSPSRALSTLSPAVSYQQIQPPPQLLQQHSLSMPVSMDQLKDMAS
QMNAILSKLADVINTGSDEKQRLRLELHKAQLRLDALKQMKRQMTEADTSPSGRTSPYAA
LLYNIPLVPYTTDDTLTGTCFSEEATAADILLQEDASIASTLSLLAQQQEEEAEMLKEKY
EMENMKQTWPLTGLLEQSTTSEHDYMHTGIQEATVTQLEEMVEHLSLCGDPQEMVPVVAT
ETQANEAELDGASLIDMSEDYDSQEVSLTDLSLLDPVSIRVSTQQQHDADLDDSERKRRN
SRTKHQERNSLSTTTEEDNSSGEERGQDGEDI
Download sequence
Identical sequences A0A0B7BJT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]