SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7BLD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7BLD0
Domain Number 1 Region: 819-1044
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-56
Family DBL homology domain (DH-domain) 0.000000912
Further Details:      
 
Domain Number 2 Region: 1053-1180
Classification Level Classification E-value
Superfamily PH domain-like 9.51e-33
Family Pleckstrin-homology domain (PH domain) 0.0000506
Further Details:      
 
Domain Number 3 Region: 319-478
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.69e-27
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 4 Region: 39-118
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-19
Family PDZ domain 0.013
Further Details:      
 
Domain Number 5 Region: 538-601
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000013
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7BLD0
Sequence length 1611
Comment (tr|A0A0B7BLD0|A0A0B7BLD0_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK93161.1} OX=1028688 OS=Arion vulgaris. GN=ORF192447 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MPLSDRLSSIGSRDQSAVAGNRDMEQTDSSGSIGGLMQKCIIIQRDDKGYGFTVSGDNPV
FVASVKQDGAAAKAGVQNGDRIIKVNGALVTQRNHLDVVKLIKSGYYVALTLLSKPSPNT
SSNLLTNTGIISSNRDSVLGRVTVPQPVNPDKDKELWQQKVHMTNTMYETAKEDFEKLQK
LYVSRPSEKLHTQLLEKERIVKALDNKLKQLTGGQDTHSSMLPSMINIPIHLSATAEHIA
TEHSSRQSWASNLPAANISDLGSMSDSPQTSPSVSPTPTDNSNRHNGQEMEDFLVGPAEI
IHIDDEEINSEDDQVNDPGPFANINLLDSRPAHMAVLLNYLISNSDPSPVLFHIISDLYS
RSPGSNKELRKWAYEMFSTFIYKLAPLSISVEDNIISQIDSILTNSGGRTDNENVLRTMF
NASRQSVQMEIAELLVDFCSKKDLGMGSLYGSQKVNDNMDRILEVKVAEELLMPHLRYFG
AEDNTRGVIVDKDLATGWALATFLRSLCGTKFTHIPILDRMQTFLMRDKKSIKFPGSRSS
RAKAVKGHQLTLQHFYVITFCNLCDHLVWGVGCQGYQCQNCDMALHKSCADDIIEQCAGK
QKKDKRIIAKLPLPGGASQPRRSSSSASGQHQPTLSVTEQVSNTASTGQQQTNEACSLPL
TDTVTTTSTQPYPRLEDTELAGLHTGHSVKSIITRYQTLTSPTGTGPGTLGVPDQEARGG
IMTTDSTKKDRRGSSDLNRSGSLNNKDEKGDRPTRRTNSDVRVDADTFKAINQSGSSSAS
SLSNWSAESAGNSTDNVSDLLRAQHEDPDLDVETELPSLKQVLPEEVLRKLKPKEKKRQE
VINELFYTERAHLRNLKVLDLLFHRPMHQEKGIMMDLARALFPNMEEIISLHVSFVKDIK
ERSQAAPVVKDVGDLLLKRFDGGAGDKFRKGCAEYCMNQSFALDALKKQTRKDLKLQQFL
HDAESNSLCRRLQLKDLVPSQMQRLTKYPLLIDNLLKYTQTTSEEYRRLERAHDRCKHIL
AHVNQAVNRCENYHKLKDIQKKLDRRSVEGLNDPALTDLKNIDLTQHKLIFDGPLTWKLR
THRMIDMHVLLFDDMLVLLQKQDDKYVLKCQNTNAQPARDDKYTHYPILKLQNLLARTLA
TEKRSFFVVNISESRAQMYEFTAASSELRLKWCKLINDKADELKKTSKLPHLSSDFSQVS
QMERGPMDRNRQSRISRKGISSVVETEADRTSSPLEEDMYQVTDDIRHHLEISEECQPQL
ELIAPEEVSISDAVVIIQSTASSSSQPRDGAAVLSPGYTCGGRYHDEPNNVQFLHQTTTV
DVPLPKEQIKNMSTQMNAILSQLAIAVSSGESDERLHLREELQKAQQGLDSLRLKQREIT
QPGTVCSERTDTCVATSYMSDGTGSPNTSSNTSYMEPVPAISSALSSFQQQEVDISSPTT
YMVGDDTLMSSSAYVTETSVFDTEEKVHHGIQEDTMSQLEESVEPLSLSNHPTDLLPVVA
TEIEASDTLSNTSIQIRGHEHDVVNVTDLQQHHSDVINPLDVNDDKLSLEQHNTNNVDDI
GATDTLTVKTNVPDFSNLTTTLEDIDGEEREVEEQADNICKTFPVPEEHDL
Download sequence
Identical sequences A0A0B7BLD0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]