SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7BLY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7BLY3
Domain Number 1 Region: 291-450
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.18e-28
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 39-119
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-19
Family PDZ domain 0.013
Further Details:      
 
Domain Number 3 Region: 510-573
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7BLY3
Sequence length 662
Comment (tr|A0A0B7BLY3|A0A0B7BLY3_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK93160.1} OX=1028688 OS=Arion vulgaris. GN=ORF192443 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MPLSDRLSSIGSRDQSAVAGNRDMEQTDSSGSIGGLMQKCIIIQRDDKGYGFTVSGDNPV
FVASVKQDGAAAKAGVQNGDRIIKVNGALVTQRNHLDVVKLIKSGYYVALTLLSKPSPNT
SSNLLTNTGIISSNRDSVLGRVTVPQPVNPDKDKELWQQKVHMTNTMYETAKEDFEKLQK
LYVSRPSEKLHTQLLEKERIVKALDNKLKQLTGGQDTHSSMASNLPAANISDLGSMSDSP
QTSPSVSPTPTDNSNRHNGQEMEDFLVGPAEIIHIDDEEINSEDDQVNDPGPFANINLLD
SRPAHMAVLLNYLISNSDPSPVLFHIISDLYSRSPGSNKELRKWAYEMFSTFIYKLAPLS
ISVEDNIISQIDSILTNSGGRTDNENVLRTMFNASRQSVQMEIAELLVDFCSKKDLGMGS
LYGSQKVNDNMDRILEVKVAEELLMPHLRYFGAEDNTRGVIVDKDLATGWALATFLRSLC
GTKFTHIPILDRMQTFLMRDKKSIKFPGSRSSRAKAVKGHQLTLQHFYVITFCNLCDHLV
WGVGCQGYQCQNCDMALHKSCADDIIEQCAGKQKKDKRIIAKLPLPGGASQPRRSSSSAS
GQHQPTLSVTEQVSNTASTGQQQTNEACSLPLTDTVTTTSTQPYPRLEDTELGATLSFIA
GL
Download sequence
Identical sequences A0A0B7BLY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]