SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7BZG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7BZG7
Domain Number 1 Region: 12-78
Classification Level Classification E-value
Superfamily PAZ domain 0.00000691
Family PAZ domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B7BZG7
Sequence length 78
Comment (tr|A0A0B7BZG7|A0A0B7BZG7_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK97560.1} OX=1028688 OS=Arion vulgaris. GN=ORF216186 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
LLESDSRMKSANDVRDGFKDQTFRGVYAKLSHRRNGNVIFMKNLSEHTGESKILDNGESH
AEYYQRRYKIKLRHPDWP
Download sequence
Identical sequences A0A0B7BZG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]