SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7C0X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7C0X6
Domain Number 1 Region: 8-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000876
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7C0X6
Sequence length 70
Comment (tr|A0A0B7C0X6|A0A0B7C0X6_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK99114.1} OX=1028688 OS=Arion vulgaris. GN=ORF220429 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
DNIQDTDKHFLEKNNVYGIMKDLLVKIVANRPDDPIQFIAKYFETLTVDDQSADLINRST
QVLSLTHHSR
Download sequence
Identical sequences A0A0B7C0X6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]