SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7DGM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7DGM0
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.29e-45
Family SMI1/KNR4-like 0.000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7DGM0
Sequence length 135
Comment (tr|A0A0B7DGM0|A0A0B7DGM0_PSEFL) Cell wall assembly protein {ECO:0000313|EMBL:ALI07501.1} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=AO356_11980 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEIIEQLREANEPVPVPLELPDEDLLVEIEEQLFIDIPFVFREFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDAGVDRSLIPICQDGDDYYCVEEDGTVVLWQAEEELIAEET
WESVWHWARDVWLES
Download sequence
Identical sequences A0A083UU86 A0A0B7DGM0 A0A0F4XPQ9 A0A0Q7AH54 A0A176NJT3 A0A1B3CD98 A0A1G5WTL6 A0A1H1MQ27 A0A1H2CUB2 A0A1H6Y3N0 A0A1H8BXP3 A0A1H8RBG7 A0A1I4BJW0 A0A1K1QTR9 A0A1N7A9M1 A0A1V3SZ42 A0A1V4FAD0 A0A231GCA7 A0A2G6UWL4 A0A2J7UNI4 A0A2K4FY75 F2K758 G8Q846 I4KMB8 J2MEI9 J2QXH0 J2TVB3 J2TXQ2 J2X378 J3HJE5 K9NSH8 S2F342 W8PZY5
gi|378953738|ref|YP_005211226.1| gi|426412288|ref|YP_007032387.1| WP_003187120.1.100503 WP_003187120.1.101805 WP_003187120.1.11011 WP_003187120.1.12124 WP_003187120.1.12382 WP_003187120.1.14013 WP_003187120.1.14589 WP_003187120.1.1542 WP_003187120.1.16574 WP_003187120.1.17350 WP_003187120.1.18615 WP_003187120.1.21623 WP_003187120.1.22661 WP_003187120.1.22851 WP_003187120.1.24733 WP_003187120.1.27757 WP_003187120.1.30140 WP_003187120.1.30946 WP_003187120.1.31021 WP_003187120.1.32411 WP_003187120.1.35230 WP_003187120.1.35287 WP_003187120.1.35613 WP_003187120.1.37263 WP_003187120.1.39650 WP_003187120.1.43403 WP_003187120.1.44535 WP_003187120.1.44632 WP_003187120.1.44965 WP_003187120.1.45064 WP_003187120.1.47548 WP_003187120.1.48140 WP_003187120.1.48623 WP_003187120.1.501 WP_003187120.1.5038 WP_003187120.1.51463 WP_003187120.1.55806 WP_003187120.1.56633 WP_003187120.1.57064 WP_003187120.1.58310 WP_003187120.1.58660 WP_003187120.1.59402 WP_003187120.1.60160 WP_003187120.1.62707 WP_003187120.1.63017 WP_003187120.1.64306 WP_003187120.1.64810 WP_003187120.1.6750 WP_003187120.1.67592 WP_003187120.1.68337 WP_003187120.1.69916 WP_003187120.1.70304 WP_003187120.1.71297 WP_003187120.1.73119 WP_003187120.1.73233 WP_003187120.1.74124 WP_003187120.1.74712 WP_003187120.1.78554 WP_003187120.1.78923 WP_003187120.1.80735 WP_003187120.1.80950 WP_003187120.1.92309 WP_003187120.1.92944 WP_003187120.1.93455 WP_003187120.1.93692 WP_003187120.1.94500 WP_003187120.1.99178 gi|330812677|ref|YP_004357139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]