SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7F1V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7F1V2
Domain Number 1 Region: 104-219
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000128
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7F1V2
Sequence length 509
Comment (tr|A0A0B7F1V2|A0A0B7F1V2_THACB) Uncharacterized protein {ECO:0000313|EMBL:CEL51480.1} KW=Complete proteome OX=1108050 OS=bottom rot fungus) (Rhizoctonia solani). GN=RSOLAG1IB_00015 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MTRPPVTLNFQSDQVDDGEISASTVKASPSVYPPPINTDLPSKPMQDNSIPPMPRPFVFS
GSTLLEIPGRLARPPSVKSIGKKWTMAPEMSVSLDEILAMRHLSPLSLKDFEQYLLFEEY
GAENLYFLLWINDYTALYHAGGSPLRLYHSLARAKATFFSSDSQYELNLAAVRISEFYAL
VDGVAPGESPDPPRPDAFAAIRGDVEVMLRTSARRFVKSRSRNAGTQRVLCIIFGGLLTM
AIALAPLMVSRFSDRNRYIRFGMIPPLWVGLTVFLCSANGICLVLYMLGGSRQLRPFELV
RPAISAPVPREPQSPYQASFTTVDTAHDVKAQPLTASFVQYPGATHSPQRPPSHVDLNSR
PDVYVLPRIRPATPIVESQFEFETAGFIPSQDDDDDTETISDRASTYVESTMAPSTSMQS
AGARSSVTKFTFDFDALPSKTLDATSGPPALEAARGKGLKGKLTKVFGPVTRVRSPVVSR
AQWEVVIRSMAVAAMFALIVSGVLVAVPI
Download sequence
Identical sequences A0A0B7F1V2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]