SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7FHS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7FHS1
Domain Number 1 Region: 136-169
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000384
Family HIT zinc finger 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B7FHS1
Sequence length 177
Comment (tr|A0A0B7FHS1|A0A0B7FHS1_THACB) Zinc finger HIT domain-containing protein 1 homolog {ECO:0000313|EMBL:CEL55768.1} KW=Complete proteome OX=1108050 OS=bottom rot fungus) (Rhizoctonia solani). GN=RSOLAG1IB_01780 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MADVSKPRARGRPRGRGGTAASRVQAPREVQNAAAAPVAPELIARRNKRRVEELERSNYA
DVKGNDLGTGLAGNRSRTTLADECNKGRKKSTAHVRSILLYRKNLNTIIEQEGLGSLPSH
VPSYLTAAAPESATEARKLCSVCGYWGHYRCPRCAEPYCDLGCKATHTDTRCERRIG
Download sequence
Identical sequences A0A0B7FHS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]