SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7FXL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7FXL9
Domain Number 1 Region: 233-372
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-28
Family cAMP-binding domain 0.00005
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-24
Family cAMP-binding domain 0.00027
Further Details:      
 
Domain Number 3 Region: 9-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7FXL9
Sequence length 527
Comment (tr|A0A0B7FXL9|A0A0B7FXL9_THACB) cAMP-dependent protein kinase regulator {ECO:0000313|EMBL:CEL62470.1} KW=Complete proteome OX=1108050 OS=bottom rot fungus) (Rhizoctonia solani). GN=RSOLAG1IB_04826 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MAAPYSSTYSELVADLTRDVQRAQPRDVLQYCANWFNSRLQEQRTRIRDAFQAQAFGRPS
AAAGLTDELFVDRAVPPRGSVPNGSMSLASSVRSSPMPSHSQPNPQAQPQHPPPHPQGTP
QPSIQQHAPQPNPFALSSGSAFSLVPGARLADPFAPSASPRPRPGPSQRAVTPSRHNTIH
EEEEPPTPSSPAAPAPSGSPAFLAPPPSALGRRVSVSAESITPSASGSLPPMPSYPKSAE
QLQRIKASIANAFLFRNLDTEQEKAVLGAMQERSVPSGERVIEQGADGDYFYVVESGSLD
CFVKRAGDNEGNVGDEVHPSYGRKVLTYTTGGTFGELALMYNAPRAATIVATEPSTLWAL
DRMSFRSIILSVANRKRKMYERFLATVPLLETLDASERSRIADVLEPRSYNEGDSVVEEG
DPGNEFFIIESGEATAFKRVKGEDGELRDDVVMKYGPGDFFGELALLHRAPRAATVRASV
TSDNNGEPNKLKVAVLDAQAFTRLLGNLKSLLDRHATQNYGASYRRN
Download sequence
Identical sequences A0A0B7FXL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]