SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7HAD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7HAD2
Domain Number 1 Region: 6-65,97-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000157
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B7HAD2
Sequence length 151
Comment (tr|A0A0B7HAD2|A0A0B7HAD2_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CEN38660.1} KW=Complete proteome OX=28189 OS=Capnocytophaga cynodegmi. GN=CCYN74_30229 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MNTHFLKEIENKLNITFPESYKKLMSEFESFCVLEYREKEIDIRNINRLSSSIDTKSDLQ
EWQYLQQWTQDNTHKQPKPELVKRNDSSETLPRERVANGFLFADGSDGVRLYFDIQDNMS
VWKYWLDEGSVGKIADCFDELLSKSEIVEQE
Download sequence
Identical sequences A0A0B7HAD2
WP_018278710.1.29325 WP_018278710.1.39465 WP_018278710.1.60294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]