SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7HDL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7HDL1
Domain Number 1 Region: 36-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.31e-18
Family SMI1/KNR4-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B7HDL1
Sequence length 197
Comment (tr|A0A0B7HDL1|A0A0B7HDL1_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CEN34080.1} KW=Complete proteome OX=28189 OS=Capnocytophaga cynodegmi. GN=CCYN74_100037 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MFEINKKEDVIIPFEKIGDENWEKNTRFILTADGDELPEVVTEEEIQEVEKRLGAKLPDS
LKLFYKTFGVADIGEELIDLDSISYLVEYLGEDNEYDSEFSEEDKEALPYLVWFGDYLGN
GNKFCFHTKTHEIYYFDHDTYPYLAKLFDDFSDYLKGCLIFKQMDYISDEKWEKFEPILE
EIVSEFINDEVIEKWRY
Download sequence
Identical sequences A0A0B7HDL1
WP_018279711.1.29325 WP_018279711.1.39465 WP_018279711.1.60294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]