SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7HFC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7HFC6
Domain Number 1 Region: 7-81,142-200
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000131
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7HFC6
Sequence length 237
Comment (tr|A0A0B7HFC6|A0A0B7HFC6_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CEN38421.1} KW=Complete proteome; Reference proteome OX=28189 OS=Capnocytophaga cynodegmi. GN=CCYN2B_50046 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MRTAMKNNDQIKRVLQKMKSLGITPNSTISLAEIHEIEATLQLKLPESYVNFLTEIQNDS
RSHQLHQKAPYYGFYSLQNALKMNEEWQITLSEPFPYIDDFEFEDVINFGENTTYDDFEK
RMETDADFADLINKYSSTNNLNGTIPICEYGCGDFFRLVVNGEKKGEIWVDCGCINLTGY
YALNVDIITFYENWLDRQIHLKSYPQDKMKYLQAYYPILEFGNNPKYKLEDSEFINP
Download sequence
Identical sequences A0A0B7HFC6
WP_052456940.1.989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]