SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7HJ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7HJ87
Domain Number 1 Region: 48-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.14e-17
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7HJ87
Sequence length 159
Comment (tr|A0A0B7HJ87|A0A0B7HJ87_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CEN38684.1} KW=Complete proteome OX=28189 OS=Capnocytophaga cynodegmi. GN=CCYN74_30235 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MKIKFEKYGLSPEKLEYMKRFNLKLDKRTTRNLINAHQTAEISTEMTCKLEEKINFNLPK
DYFDFLLKQNGGIPSKSRIKSKVIDHFLSLKSDYKYNSIVDLLEEFASKGLPIATDPSGN
YFLMKNDGKIYYFDHNSGEIDEKSGILAKNFTDLLENLK
Download sequence
Identical sequences A0A0B7HJ87
WP_018278716.1.29325 WP_018278716.1.39465 WP_018278716.1.60294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]