SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7HL50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7HL50
Domain Number 1 Region: 24-89,123-201
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000968
Family SMI1/KNR4-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7HL50
Sequence length 450
Comment (tr|A0A0B7HL50|A0A0B7HL50_9FLAO) Putative glucan synthasis protein {ECO:0000313|EMBL:CEN38612.1} KW=Complete proteome OX=28189 OS=Capnocytophaga cynodegmi. GN=CCYN74_30211 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MILFEEQITRIKQKLQKAKEIDKELKVFGAKSHKYELGKPISEEKLQQLEQKYKISFPDC
FRSFLLYIGNGREKQFAGAAPFYGLYPVEKCIKESKEGFYFPCVIYPKMSDENWDKIVAK
LDDENISDEDYDKEVGKIFGSLLTFGTQGCTYDTAIVLEGKHRGRVVNIDIDFQKPHFAF
EKNFLDWYERWLDEIISGEILYQSNGFSYQMGGSAEELLSIFENSSDKEEKTDALLGLRH
KKPPLPAEILNKIENYTQKEDFYFQYFVTILCISDFERAKKYFSQLAEHNLLRFFQNIFW
YSQNKKKDSRDLLPIIREKLPNITDEEIFRFCGYVLRETDLDYGKWIAPFVQNKDYKIRS
DVFYTLGQLKNKEKYLDIFIKGLYDEKSFVVMTDLQALNGIKNEVLLPHYKQVATRFPEE
NEEEYYVYNNLNHRLKEFGLSVEEILKMDF
Download sequence
Identical sequences A0A0B7HL50
WP_041996668.1.60294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]