SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7HMX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7HMX8
Domain Number 1 Region: 157-201,245-324
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000222
Family SMI1/KNR4-like 0.013
Further Details:      
 
Domain Number 2 Region: 413-556
Classification Level Classification E-value
Superfamily Suppressor of Fused, N-terminal domain 0.00000034
Family Suppressor of Fused, N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7HMX8
Sequence length 691
Comment (tr|A0A0B7HMX8|A0A0B7HMX8_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CEN39227.1} KW=Complete proteome OX=28188 OS=Capnocytophaga canimorsus. GN=CCAN12_760003 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MTEKQILKKIDAWDENDNIQAIIDFIENLPVEERSTAVLSELGRAYNNFYWLDQSAENEK
YLQKAIDVFKYLEEELGETASWNYRIGYSYFYLNNSELAKKHFLREQELQGSGNDVDTYL
ACIEYAQEKGVSPVEVYNGGREGVQYPLERFLHFLEKKAPNLRTLIASGASDAELESFEN
QIGAKLPEAYKELYRTFNGQKQIVPFFATGNQHFVSLSEVTEIQERWLSFVKQHYGENWK
NVRLSEEIFFDEEDVQNTLFNEKWIPILAGEQFFICMDLDPKQEEFYGQIICVMLNEDIN
NFEVGYLYNDIKDWLGYIIRNLQSEQLVYNAENNCLEFAEDGNYQEAAYYTEEERTALES
YIEITFGKFDEVLHELVSPDIHCDIYLIKPTPERNYYTLVTGGMGAFQMYTPEDYHASPF
AELVINLPPTWNIQSEEEKDYWPIRWLKNLARLPIQHQTYLGYGHTIPTNDALEGTNFDC
LMLIGAVTQSEDGEQSQWAVAELPSGKEVGFFYVVPLYPEETQFKLDQSADDLLDKFEEA
DIPYPPVVDINRVNVCEDYEAMETPNLLDNIAWAFNDRFYGSLMHFWDAIRDYNADIEND
LEDFTPFATIFSSSKVMMMYEAYIKSEKDILENERLLNPETFDDPDEDGMYYARILAELE
SEDRNYYGALNLLRHIHNTLSNKDFRRPYFL
Download sequence
Identical sequences A0A0B7HMX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]