SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7IA02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7IA02
Domain Number 1 Region: 10-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-17
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7IA02
Sequence length 140
Comment (tr|A0A0B7IA02|A0A0B7IA02_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CEN48570.1} KW=Complete proteome OX=28188 OS=Capnocytophaga canimorsus. GN=CCAN11_1760005 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MEFSQTEQKLTLADMDDFERKIGLKLPQDFKEHYLKFNGGYPSFEYVKGLRNIFTINSFD
SIKYGALPIEKLIDDFQESGVDFNNKIPFANDNGDNIFLISLDDSDYGKIYIIEAEFLEN
KNYILVSESFTDFLNSFFNE
Download sequence
Identical sequences A0A0B7IA02
WP_041985372.1.48300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]