SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7IFN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7IFN7
Domain Number 1 Region: 23-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000157
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7IFN7
Sequence length 207
Comment (tr|A0A0B7IFN7|A0A0B7IFN7_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:CEN49474.1} KW=Complete proteome OX=28188 OS=Capnocytophaga canimorsus. GN=CCAN2_1990033 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MNSVKSIYPVSKSENLEKLTAFEQAYFNIPNDFREYLINYNVAKPRKTYYKDRVEFDLNY
LFGFSKNAYEDFLETIKTYTNRTDKNLFPIGSVDGGDLLCMDKNTQEIYYWNHEINDQGL
EGNNTPATKISANLDEFLESLTISSEPTEYEIKRAIQNAVVTTTPKGVEIRNEQRKKKGL
RPLTIEEWHAKLNGIYDPDTVNPNQST
Download sequence
Identical sequences A0A0B7IFN7
WP_044729787.1.42114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]