SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7IR26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7IR26
Domain Number 1 Region: 142-329
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000157
Family SMI1/KNR4-like 0.01
Further Details:      
 
Domain Number 2 Region: 435-558
Classification Level Classification E-value
Superfamily Suppressor of Fused, N-terminal domain 0.0000157
Family Suppressor of Fused, N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B7IR26
Sequence length 709
Comment (tr|A0A0B7IR26|A0A0B7IR26_9FLAO) Suppressor of fused protein {ECO:0000313|EMBL:CEN54361.1} KW=Complete proteome OX=1848903 OS=Capnocytophaga canis. GN=CCAND93_840045 OC=Flavobacteriaceae; Capnocytophaga.
Sequence
MTEKQILAKIEKWDKDNKVSAIIEFIENLPVQQKTSQVLSELGRAYNNFYWLMPSEENRA
YLQKAVSVFNYVKDDIPSQIWHYRIGYAYFFLDNIEKAKEHLSHASEGNGKDLLEFLKIA
EQKGLKPTEVAPQGALKFEFLFEKFIALIQEKAPALVSVLGKGASDTTLDAFEQRKGINL
PEDVRYFYKTFDGQTDNNVFFLNNAQRFISIQEVEELQKRWLSFVVNNYGKNWQDLTFSS
DDFFDDDIIKNQLFSQRWIPFLMQHNEQGNEEYLCFDFDSINEEDFGQLISVSLSDKLQS
YYVDYVSPNIWSWLYTTTKNIEEGFVVYDEKLNSLMFTTTDDFSAVYYTEDELDTLKNYI
SENIGQIDDVLPGLISSDIRCDIYIIKPTPERNYYTLITGGMGAFDMLVPQDHEGSTNAE
LMINLPPDWNVYGNDEKDFWPIRWLKTLAQLPIEQQTFLDWGHTIPTGEPLPDTPFTCLM
LIGSETKDRSNALVTLPTGRQVQFFTLVPLYEEEMLYKLQNMAEALIERFEAKAIPYPPV
VDVNRLNVCENFVPSENHAALDGVAWAFNKINYVGLMQFWDDVRAYNEYIEQDLDYFNPF
TTLFKTSKVKVIYEAWVRSEKDLLPFEEFVEPIDNIFNQYNEQNGFYQAEIIAELQSGDN
NSFGALELLWNIHNCLQNKELGDNIFFEGFEIEGYEDDITPVIYLCLGD
Download sequence
Identical sequences A0A0B7IR26
WP_042009941.1.62147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]