SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B7KDK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B7KDK8
Domain Number 1 Region: 370-458,512-535
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000151
Family Regulator of G-protein signaling, RGS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B7KDK8
Sequence length 571
Comment (tr|A0A0B7KDK8|A0A0B7KDK8_BIOOC) Uncharacterized protein {ECO:0000313|EMBL:CEO55174.1} OX=29856 OS=Bionectria ochroleuca (Gliocladium roseum). GN=BN869_000011232_1 OC=Clonostachys.
Sequence
MDGVPNFTIYNLPPSPPKWDNIGIFFICFCCIWTTFVFAGMAFCWYNRNNPILKIRGLPL
SFTAILFLHSYWVLAQLVYPIGGTMPVVLAYDIQYFFMGIWFPLGIALFHASNSRFLHVA
KLQKQFTNDHRVQVRCNGGGSSWICRFRNMSYSVRIMTFIGLGMIAQVLLTVGMWLACRK
YHPTFGIPGTEIRGATLVEQMVDLGRGWEWWPSVVWQVIWTWMVAPYLLWRAWDIRDTMG
WRAQTIGCCISNLHATPMFLIAQYVPAFAPVNMYYPPSQWIHLSVMMFEIFTVFVPVFQV
IKLNIQRRKVAASNERWESSSQITMFGSVQSSDQERKGSTSSRGKSDIMDNLLNNEMSDH
LYTIGALDYVLRENPTPLQNFSALSDFSGENIAFLTRAAAWKNTFSGDFRGEKELDAYNA
ALQLYTDFISPRDAEFPLNLSGPELRRLEDIFEAPTRILCGEPVVNTATPFDIEQPELPG
SSDGCSSASNSSTTRLRAKYTGEIPPGFDDLVFDSTCSHIKYLVLTNTWPKFVDDIRNQN
RRSSESGRTFDSNDSDQTLASRVTTYVRSMF
Download sequence
Identical sequences A0A0B7KDK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]